Lineage for d3tkyd1 (3tky D:9-122)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694648Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries)
  8. 2694666Domain d3tkyd1: 3tky D:9-122 [216863]
    Other proteins in same PDB: d3tkya2, d3tkyb2, d3tkyc2, d3tkyd2
    automated match to d1kyze1
    complexed with n7i, sah

Details for d3tkyd1

PDB Entry: 3tky (more details), 2.47 Å

PDB Description: monolignol o-methyltransferase (momt)
PDB Compounds: (D:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d3tkyd1:

Sequence, based on SEQRES records: (download)

>d3tkyd1 a.4.5.0 (D:9-122) automated matches {Clarkia breweri [TaxId: 36903]}
iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaq
lpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

Sequence, based on observed residues (ATOM records): (download)

>d3tkyd1 a.4.5.0 (D:9-122) automated matches {Clarkia breweri [TaxId: 36903]}
iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksgyispaeiaaqlptt
npeapvmldrvlrllasysvvtytlrerlyglapvckfltkne

SCOPe Domain Coordinates for d3tkyd1:

Click to download the PDB-style file with coordinates for d3tkyd1.
(The format of our PDB-style files is described here.)

Timeline for d3tkyd1: