PDB entry 3tky

View 3tky on RCSB PDB site
Description: Monolignol o-methyltransferase (momt)
Class: transferase
Keywords: directed evolution, saturation mutagenesis, regioselectivity, transferase
Deposited on 2011-08-29, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.193
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385
      • engineered mutation (132)
      • engineered mutation (164)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d3tkya1, d3tkya2
  • Chain 'B':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385
      • engineered mutation (132)
      • engineered mutation (164)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d3tkyb1, d3tkyb2
  • Chain 'C':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385
      • engineered mutation (132)
      • engineered mutation (164)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d3tkyc1, d3tkyc2
  • Chain 'D':
    Compound: (Iso)eugenol O-methyltransferase
    Species: Clarkia breweri [TaxId:36903]
    Gene: IEMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04385
      • engineered mutation (132)
      • engineered mutation (164)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d3tkyd1, d3tkyd2
  • Heterogens: N7I, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tkyA (A:)
    mgstgnaeiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tkyA (A:)
    ssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe
    apvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltknedgvslapflllat
    dkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfnkgmssnstitmkkil
    emyngfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsgvehlggdm
    fdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspdpsiatkv
    vihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tkyB (B:)
    mgstgnaeiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tkyB (B:)
    iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvgyispaeiaaqlpt
    tnpeapvmldrvlrllasysvvtytlrerlyglapvckfltknedgvslapflllatdkv
    llepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfnkgmssnstitmkkilemy
    ngfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsgvehlggdmfdg
    vpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspdpsiatkvvih
    tdalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tkyC (C:)
    mgstgnaeiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tkyC (C:)
    ssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe
    apvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltknedgvslapflllat
    dkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfnkgmssnstitmkkil
    emyngfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsgvehlggdm
    fdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspdpsiatkv
    vihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tkyD (D:)
    mgstgnaeiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyi
    spaeiaaqlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltk
    nedgvslapflllatdkvllepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfn
    kgmssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviq
    dapafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivae
    yilppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafnty
    vmeflkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tkyD (D:)
    iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksgyispaeiaaqlptt
    npeapvmldrvlrllasysvvtytlrerlyglapvckfltknedgvslapflllatdkvl
    lepwfylkdaileggipfnkaygmnifdyhgtdhrinkvfnkgmssnstitmkkilemyn
    gfeglttivdvgggtgavasmivakypsinainfdlphviqdapafsgvehlggdmfdgv
    pkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyilppspdpsiatkvviht
    dalmlaynpggkertekefqalamasgfrgfkvascafntyvmeflkt