Lineage for d3tkyb1 (3tky B:9-122)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308050Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries)
  8. 2308066Domain d3tkyb1: 3tky B:9-122 [216859]
    Other proteins in same PDB: d3tkya2, d3tkyb2, d3tkyc2, d3tkyd2
    automated match to d1kyze1
    complexed with n7i, sah

Details for d3tkyb1

PDB Entry: 3tky (more details), 2.47 Å

PDB Description: monolignol o-methyltransferase (momt)
PDB Compounds: (B:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d3tkyb1:

Sequence, based on SEQRES records: (download)

>d3tkyb1 a.4.5.0 (B:9-122) automated matches {Clarkia breweri [TaxId: 36903]}
iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaq
lpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

Sequence, based on observed residues (ATOM records): (download)

>d3tkyb1 a.4.5.0 (B:9-122) automated matches {Clarkia breweri [TaxId: 36903]}
iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvgyispaeiaaqlpt
tnpeapvmldrvlrllasysvvtytlrerlyglapvckfltkne

SCOPe Domain Coordinates for d3tkyb1:

Click to download the PDB-style file with coordinates for d3tkyb1.
(The format of our PDB-style files is described here.)

Timeline for d3tkyb1: