![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
![]() | Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
![]() | Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
![]() | Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [81910] (1 species) Suppressor of kinetochore protein 1,Scskp1 |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81911] (2 PDB entries) |
![]() | Domain d3mksa2: 3mks A:116-185 [213309] Other proteins in same PDB: d3mksa1, d3mksb1, d3mksb2, d3mksc1, d3mksd1, d3mksd2 automated match to d1nexa1 complexed with c1c, gol, so4 |
PDB Entry: 3mks (more details), 2.6 Å
SCOPe Domain Sequences for d3mksa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mksa2 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vdswdreflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivnd ftpeeeaair
Timeline for d3mksa2: