Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [82639] (1 species) Suppressor of kinetochore protein 1,Scskp1 |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82640] (2 PDB entries) |
Domain d3mksc1: 3mks C:4-103 [213312] Other proteins in same PDB: d3mksa2, d3mksb1, d3mksb2, d3mksc2, d3mksd1, d3mksd2 automated match to d1nexc2 complexed with c1c, gol, so4 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 3mks (more details), 2.6 Å
SCOPe Domain Sequences for d3mksc1:
Sequence, based on SEQRES records: (download)
>d3mksc1 d.42.1.1 (C:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} snvvlvsgegerftvdkkiaerslllknylndmgddddedddeivmpvpnvrssvlqkvi ewaehhrdsnfp
>d3mksc1 d.42.1.1 (C:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} snvvlvsgegerftvdkkiaerslllknylnivmpvpnvrssvlqkviewaehhrdsnfp
Timeline for d3mksc1: