Lineage for d3mksc1 (3mks C:4-103)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945514Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [82639] (1 species)
    Suppressor of kinetochore protein 1,Scskp1
  7. 2945515Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82640] (2 PDB entries)
  8. 2945519Domain d3mksc1: 3mks C:4-103 [213312]
    Other proteins in same PDB: d3mksa2, d3mksb1, d3mksb2, d3mksc2, d3mksd1, d3mksd2
    automated match to d1nexc2
    complexed with c1c, gol, so4

    missing some secondary structures that made up less than one-third of the common domain

Details for d3mksc1

PDB Entry: 3mks (more details), 2.6 Å

PDB Description: crystal structure of yeast cdc4/skp1 in complex with an allosteric inhibitor scf-i2
PDB Compounds: (C:) Suppressor of kinetochore protein 1

SCOPe Domain Sequences for d3mksc1:

Sequence, based on SEQRES records: (download)

>d3mksc1 d.42.1.1 (C:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snvvlvsgegerftvdkkiaerslllknylndmgddddedddeivmpvpnvrssvlqkvi
ewaehhrdsnfp

Sequence, based on observed residues (ATOM records): (download)

>d3mksc1 d.42.1.1 (C:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snvvlvsgegerftvdkkiaerslllknylnivmpvpnvrssvlqkviewaehhrdsnfp

SCOPe Domain Coordinates for d3mksc1:

Click to download the PDB-style file with coordinates for d3mksc1.
(The format of our PDB-style files is described here.)

Timeline for d3mksc1: