SCOPe 2.08: Domain d3mksc2: 3mks C:116-186

Lineage for d3mksc2 (3mks C:116-186)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [81910] (1 species)
   Suppressor of kinetochore protein 1,Scskp1

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81911] (2 PDB entries)

8. Domain d3mksc2: 3mks C:116-186 [213313]
   Other proteins in same PDB: d3mksa1, d3mksb1, d3mksb2, d3mksc1, d3mksd1, d3mksd2
   automated match to d1nexc1
   complexed with c1c, gol, so4

Details for d3mksc2

PDB Entry: 3mks, 2.6 Å

PDB Description: crystal structure of yeast cdc4/skp1 in complex with an allosteric inhibitor scf-i2

PDB Compounds: (C:) Suppressor of kinetochore protein 1

SCOPe Domain Sequences for d3mksc2:

Sequence; same for both SEQRES and ATOM records:

>d3mksc2 a.157.1.1 (C:116-186) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vdswdreflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivnd
ftpeeeaairr

Timeline for d3mksc2:

• d3mksc2 first appeared in SCOPe 2.03
  
• d3mksc2 appears in SCOPe 2.07