Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (4 families) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (17 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein Cdc4 propeller domain [82169] (1 species) 8-bladed beta-propeller without perfect 8-fold symmetry |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82170] (2 PDB entries) |
Domain d3mksb2: 3mks B:370-744 [213311] Other proteins in same PDB: d3mksa1, d3mksa2, d3mksb1, d3mksc1, d3mksc2, d3mksd1 automated match to d1nexb2 complexed with c1c, gol, so4 applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 3mks (more details), 2.6 Å
SCOPe Domain Sequences for d3mksb2:
Sequence, based on SEQRES records: (download)
>d3mksb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fvpqrttlrghmtsvitclqfednyvitgaddkmirvydsinkkfllqlsghdggvwalk yahggilvsgstdrtvrvwdikkgccthvfeghnstvrcldiveyknikyivtgsrdntl hvwklpkessvpdhgeehdyplvfhtpeenpyfvgvlrghmasvrtvsghgnivvsgsyd ntlivwdvaqmkclyilsghtdriystiydherkrcisasmdttiriwdlengelmytlq ghtalvgllrlsdkflvsaaadgsirgwdandysrkfsyhhtnlsaittfyvsdnilvsg senqfniynlrsgklvhanilkdadqiwsvnfkgktlvaavekdgqsfleildfs
>d3mksb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fvpqrttlrghmtsvitclqfednyvitgaddkmirvydsinkkfllqlsghdggvwalk yahggilvsgstdrtvrvwdikkgccthvfeghnstvrcldiveyknikyivtgsrdntl hvwklpkdyplvfhtpeenpyfvgvlrghmasvrtvsghgnivvsgsydntlivwdvaqm kclyilsghtdriystiydherkrcisasmdttiriwdlengelmytlqghtalvgllrl sdkflvsaaadgsirgwdandysrkfsyhhtnlsaittfyvsdnilvsgsenqfniynlr sgklvhanilkdadqiwsvnfkgktlvaavekdgqsfleildfs
Timeline for d3mksb2: