SCOPe 2.08: Domain d3mksb1: 3mks B:270-369

Lineage for d3mksb1 (3mks B:270-369)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.158: F-box domain [81385] (1 superfamily)
   multihelical; interlocked heterodimer with the Skp1 dimerisation domain

4. Superfamily a.158.1: F-box domain [81383] (1 family)

5. Family a.158.1.1: F-box domain [81381] (4 proteins)

6. Protein Cdc4 F-box and linker domains [81912] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81913] (2 PDB entries)

8. Domain d3mksb1: 3mks B:270-369 [213310]
   Other proteins in same PDB: d3mksa1, d3mksa2, d3mksb2, d3mksc1, d3mksc2, d3mksd2
   automated match to d1nexb1
   complexed with c1c, gol, so4

Details for d3mksb1

PDB Entry: 3mks, 2.6 Å

PDB Description: crystal structure of yeast cdc4/skp1 in complex with an allosteric inhibitor scf-i2

PDB Compounds: (B:) Cell division control protein 4

SCOPe Domain Sequences for d3mksb1:

Sequence; same for both SEQRES and ATOM records:

>d3mksb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkrdlitslpfeislkifnylqfediinslgvsqnwnkiirkstslwkkllisenfvspk
gfnslnlklsqkypklsqqdrlrlsflenifilknwynpk

Timeline for d3mksb1:

• d3mksb1 first appeared in SCOPe 2.03
  
• d3mksb1 appears in SCOPe 2.07