SCOPe 2.08: Domain d4i7zg_: 4i7z G:

Lineage for d4i7zg_ (4i7z G:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family)

5. Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins)

6. Protein automated matches [196847] (1 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [196848] (5 PDB entries)

8. Domain d4i7zg_: 4i7z G: [196849]
   Other proteins in same PDB: d4i7za_, d4i7zb_, d4i7zc1, d4i7zc2, d4i7zc3, d4i7ze_, d4i7zf_, d4i7zh_
   automated match to d2e74g1
   complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq

Details for d4i7zg_

PDB Entry: 4i7z, 2.8 Å

PDB Description: crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain

PDB Compounds: (G:) Cytochrome b6-f complex subunit 5

SCOPe Domain Sequences for d4i7zg_:

Sequence; same for both SEQRES and ATOM records:

>d4i7zg_ f.23.26.1 (G:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
eplldglvlglvfatlgglfyaayqqykrpnelgg

Timeline for d4i7zg_:

• d4i7zg_ first appeared in SCOPe 2.02
  
• d4i7zg_ appears in SCOPe 2.07