![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
![]() | Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein) |
![]() | Protein Cytochrome f, small domain [51257] (5 species) |
![]() | Species Mastigocladus laminosus [TaxId:83541] [102005] (2 PDB entries) |
![]() | Domain d4i7zc2: 4i7z C:170-231 [202584] Other proteins in same PDB: d4i7za_, d4i7zb_, d4i7zc1, d4i7zc3, d4i7ze_, d4i7zf_, d4i7zg_, d4i7zh_ automated match to d1vf5c2 complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq |
PDB Entry: 4i7z (more details), 2.8 Å
SCOPe Domain Sequences for d4i7zc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7zc2 b.84.2.2 (C:170-231) Cytochrome f, small domain {Mastigocladus laminosus [TaxId: 83541]} nvftasatgtitkiakeedeygnvkyqvsiqtdsgktvvdtipagpelivsegqavkage al
Timeline for d4i7zc2: