SCOPe 2.08: Domain d4i7zf_: 4i7z F:

Lineage for d4i7zf_ (4i7z F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family)

5. Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)

6. Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103444] (9 PDB entries)

8. Domain d4i7zf_: 4i7z F: [192927]
   Other proteins in same PDB: d4i7za_, d4i7zb_, d4i7zc1, d4i7zc2, d4i7zc3, d4i7ze_, d4i7zg_, d4i7zh_
   automated match to d1vf5s_
   complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq

Details for d4i7zf_

PDB Entry: 4i7z, 2.8 Å

PDB Description: crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain

PDB Compounds: (F:) Cytochrome b6-f complex subunit 7

SCOPe Domain Sequences for d4i7zf_:

Sequence; same for both SEQRES and ATOM records:

>d4i7zf_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
teemlyaallsfglifvgwglgvlllkiqga

Timeline for d4i7zf_:

• d4i7zf_ first appeared in SCOPe 2.02
  
• d4i7zf_ appears in SCOPe 2.07