![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) ![]() |
![]() | Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins) |
![]() | Protein PetM subunit of the cytochrome b6f complex [103443] (2 species) |
![]() | Species Mastigocladus laminosus [TaxId:83541] [103444] (9 PDB entries) |
![]() | Domain d4i7zf_: 4i7z F: [192927] Other proteins in same PDB: d4i7za_, d4i7zb_, d4i7zc1, d4i7zc2, d4i7zc3, d4i7ze_, d4i7zg_, d4i7zh_ automated match to d1vf5s_ complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq |
PDB Entry: 4i7z (more details), 2.8 Å
SCOPe Domain Sequences for d4i7zf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7zf_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} teemlyaallsfglifvgwglgvlllkiqga
Timeline for d4i7zf_: