Lineage for d4i7zf_ (4i7z F:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026305Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) (S)
  5. 3026306Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)
  6. 3026307Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)
  7. 3026310Species Mastigocladus laminosus [TaxId:83541] [103444] (9 PDB entries)
  8. 3026314Domain d4i7zf_: 4i7z F: [192927]
    Other proteins in same PDB: d4i7za_, d4i7zb_, d4i7zc1, d4i7zc2, d4i7zc3, d4i7ze_, d4i7zg_, d4i7zh_
    automated match to d1vf5s_
    complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq

Details for d4i7zf_

PDB Entry: 4i7z (more details), 2.8 Å

PDB Description: crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain
PDB Compounds: (F:) Cytochrome b6-f complex subunit 7

SCOPe Domain Sequences for d4i7zf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i7zf_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
teemlyaallsfglifvgwglgvlllkiqga

SCOPe Domain Coordinates for d4i7zf_:

Click to download the PDB-style file with coordinates for d4i7zf_.
(The format of our PDB-style files is described here.)

Timeline for d4i7zf_: