SCOPe 2.08: Domain d4i7zb_: 4i7z B:

Lineage for d4i7zb_ (4i7z B:)

1. Root: SCOPe 2.08
2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle
4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)
5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
6. Protein Subunit IV of the cytochrome b6f complex [103495] (2 species)
7. Species Mastigocladus laminosus [TaxId:83541] [103496] (8 PDB entries)
8. Domain d4i7zb_: 4i7z B: [192679]
   Other proteins in same PDB: d4i7za_, d4i7zc1, d4i7zc2, d4i7zc3, d4i7ze_, d4i7zf_, d4i7zg_, d4i7zh_
   automated match to d2e74b1
   complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq

Details for d4i7zb_

PDB Entry: 4i7z, 2.8 Å

PDB Description: crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain

PDB Compounds: (B:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d4i7zb_:

Sequence; same for both SEQRES and ATOM records:

>d4i7zb_ f.32.1.1 (B:) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
atlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpam
vgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkfq
npfrrpvattiflfgtlvtiwlgigatfpldktltlglf

SCOPe Domain Coordinates for d4i7zb_ are not available.

Timeline for d4i7zb_:

• d4i7zb_ first appeared in SCOPe 2.02
  
• d4i7zb_ appears in SCOPe 2.07