PDB entry 4i7z

View 4i7z on RCSB PDB site
Description: Crystal structure of cytochrome b6f in DOPG, with disordered Rieske Iron-Sulfur Protein soluble domain
Class: photosynthesis
Keywords: cytochrome, membrane protein, plastoquinol:plastocyanin oxidoreductase, plastocyanin, thylakoid membrane, photosynthesis
Deposited on 2012-12-01, released 2013-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b6
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i7za_
  • Chain 'B':
    Compound: Cytochrome b6-f complex subunit 4
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i7zb_
  • Chain 'C':
    Compound: Apocytochrome f
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83793 (0-End)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d4i7zc1, d4i7zc2, d4i7zc3
  • Chain 'D':
    Compound: Cytochrome b6-f complex iron-sulfur subunit
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Cytochrome b6-f complex subunit 6
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i7ze_
  • Chain 'F':
    Compound: Cytochrome b6-f complex subunit 7
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i7zf_
  • Chain 'G':
    Compound: Cytochrome b6-f complex subunit 5
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i7zg_
  • Chain 'H':
    Compound: Cytochrome b6-f complex subunit 8
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i7zh_
  • Heterogens: HEM, MYS, 8K6, UMQ, CD, CLA, OZ2, 1E2, OCT, BCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i7zA (A:)
    manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp
    tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis
    gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
    tryysahtfvlpwliavfmllhflmirkqgisgpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i7zA (A:)
    nvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptv
    teayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgv
    ilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltr
    yysahtfvlpwliavfmllhflmirkqgisgpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i7zB (B:)
    matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
    mvgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkf
    qnpfrrpvattiflfgtlvtiwlgigatfpldktltlglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i7zB (B:)
    atlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpam
    vgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkfq
    npfrrpvattiflfgtlvtiwlgigatfpldktltlglf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4i7zC (C:)
    ypfwaqqtypptpreptgrivcanchlaakpaevevpqsvlpdtvfkavvkipydtklqq
    vaadgskvglnvgavlmlpegfkiapeeripeelkkevgdvyfqpykegqdnvllvgplp
    geqyqeivfpvlspnpttdknihfgkyaihlganrgrgqiyptgeksnnnvftasatgti
    tkiakeedeygnvkyqvsiqtdsgktvvdtipagpelivsegqavkagealtnnpnvggf
    gqddteivlqdpnrvkwmiaficlvmlaqlmlilkkkqvekvqaaemnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i7zC (C:)
    ypfwaqqtypptpreptgrivcanchlaakpaevevpqsvlpdtvfkavvkipydtklqq
    vaadgskvglnvgavlmlpegfkiapeeripeelkkevgdvyfqpykegqdnvllvgplp
    geqyqeivfpvlspnpttdknihfgkyaihlganrgrgqiyptgeksnnnvftasatgti
    tkiakeedeygnvkyqvsiqtdsgktvvdtipagpelivsegqavkagealtnnpnvggf
    gqddteivlqdpnrvkwmiaficlvmlaqlmlilkkkqvekvqaaemn
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4i7zE (E:)
    milgavfyivfialffgiavgiifaiksikli
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i7zE (E:)
    ilgavfyivfialffgiavgiifaiksi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4i7zF (F:)
    mteemlyaallsfglifvgwglgvlllkiqgaeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i7zF (F:)
    teemlyaallsfglifvgwglgvlllkiqga
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4i7zG (G:)
    mveplldglvlglvfatlgglfyaayqqykrpnelgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i7zG (G:)
    eplldglvlglvfatlgglfyaayqqykrpnelgg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4i7zH (H:)
    meidvlgwvallvvftwsiamvvwgrngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i7zH (H:)
    eidvlgwvallvvftwsiamvvwgrngl