Lineage for d4i7zc3 (4i7z C:250-288)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026281Superfamily f.23.23: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103431] (1 family) (S)
  5. 3026282Family f.23.23.1: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103432] (1 protein)
  6. 3026283Protein Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103433] (2 species)
  7. 3026286Species Mastigocladus laminosus [TaxId:83541] [103434] (2 PDB entries)
  8. 3026287Domain d4i7zc3: 4i7z C:250-288 [202585]
    Other proteins in same PDB: d4i7za_, d4i7zb_, d4i7zc1, d4i7zc2, d4i7ze_, d4i7zf_, d4i7zg_, d4i7zh_
    automated match to d1vf5c3
    complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq

Details for d4i7zc3

PDB Entry: 4i7z (more details), 2.8 Å

PDB Description: crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain
PDB Compounds: (C:) Apocytochrome f

SCOPe Domain Sequences for d4i7zc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i7zc3 f.23.23.1 (C:250-288) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
qdpnrvkwmiaficlvmlaqlmlilkkkqvekvqaaemn

SCOPe Domain Coordinates for d4i7zc3:

Click to download the PDB-style file with coordinates for d4i7zc3.
(The format of our PDB-style files is described here.)

Timeline for d4i7zc3: