Lineage for d1hjpa2 (1hjp A:65-140)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715662Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2715663Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)
  6. 2715664Protein DNA helicase RuvA subunit, middle domain [47783] (3 species)
    tetramer; binds Holliday junction
  7. 2715665Species Escherichia coli [TaxId:562] [47784] (5 PDB entries)
  8. 2715667Domain d1hjpa2: 1hjp A:65-140 [17947]
    Other proteins in same PDB: d1hjpa1, d1hjpa3

Details for d1hjpa2

PDB Entry: 1hjp (more details), 2.5 Å

PDB Description: holliday junction binding protein ruva from e. coli
PDB Compounds: (A:) ruva

SCOPe Domain Sequences for d1hjpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjpa2 a.60.2.1 (A:65-140) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlf

SCOPe Domain Coordinates for d1hjpa2:

Click to download the PDB-style file with coordinates for d1hjpa2.
(The format of our PDB-style files is described here.)

Timeline for d1hjpa2: