| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein) barrel, closed; n=5, S=10 automatically mapped to Pfam PF01330 |
| Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species) tetramer; binds Holliday junction |
| Species Escherichia coli [TaxId:562] [50261] (5 PDB entries) |
| Domain d1hjpa3: 1hjp A:1-64 [25266] Other proteins in same PDB: d1hjpa1, d1hjpa2 |
PDB Entry: 1hjp (more details), 2.5 Å
SCOPe Domain Sequences for d1hjpa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjpa3 b.40.4.2 (A:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli [TaxId: 562]}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn
Timeline for d1hjpa3: