Lineage for d1hjpa1 (1hjp A:158-203)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696010Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) (S)
    possibly related to UBA-like domains
  5. 2696011Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein)
  6. 2696012Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species)
    tetramer; binds Holliday junction
  7. 2696013Species Escherichia coli [TaxId:562] [46932] (4 PDB entries)
  8. 2696015Domain d1hjpa1: 1hjp A:158-203 [16274]
    Other proteins in same PDB: d1hjpa2, d1hjpa3

Details for d1hjpa1

PDB Entry: 1hjp (more details), 2.5 Å

PDB Description: holliday junction binding protein ruva from e. coli
PDB Compounds: (A:) ruva

SCOPe Domain Sequences for d1hjpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjpa1 a.5.1.1 (A:158-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]}
daeqeavaalvalgykpqeasrmvskiarpdassetlirealraal

SCOPe Domain Coordinates for d1hjpa1:

Click to download the PDB-style file with coordinates for d1hjpa1.
(The format of our PDB-style files is described here.)

Timeline for d1hjpa1: