PDB entry 1hjp

View 1hjp on RCSB PDB site
Description: holliday junction binding protein ruva from e. coli
Class: DNA recombination
Keywords: DNA recombination, DNA repair, holliday junction binding
Deposited on 1997-08-21, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ruva
    Species: Escherichia coli [TaxId:562]
    Gene: ruvA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hjpa1, d1hjpa2, d1hjpa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hjpA (A:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftpaadlvltspaspatddaeqeavaalvalgykpqeasrm
    vskiarpdassetlirealraal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hjpA (A:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlfdaeqeavaalvalgykpqeasrmvskiarpdassetlire
    alraal