Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins) |
Protein Cbl [47561] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47562] (12 PDB entries) |
Domain d2cbla1: 2cbl A:178-263 [17380] Other proteins in same PDB: d2cbla2, d2cbla3 complexed with ca |
PDB Entry: 2cbl (more details), 2.1 Å
SCOPe Domain Sequences for d2cbla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbla1 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]} tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis vfefdiftrlfqpwssllrnwnslav
Timeline for d2cbla1: