PDB entry 2cbl

View 2cbl on RCSB PDB site
Description: n-terminal domain of cbl in complex with its binding site on zap-70
Class: complex (proto-oncogene/peptide)
Keywords: proto-oncogene, signal transduction, phosphotyrosine binding, sh2, complex (proto-oncogene/peptide)
Deposited on 1998-08-28, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.173
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proto-oncogene cbl
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cbla1, d2cbla2, d2cbla3
  • Chain 'B':
    Compound: zap-70
    Database cross-references and differences (RAF-indexed):
    • PDB 2CBL (Start-11)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cblA (A:)
ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
gifpsglfqgdtfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalks
tidltcndyisvfefdiftrlfqpwssllrnwnslavthpgymafltydevkarlqkfih
kpgsyifrlsctrlgqwaigyvtadgnilqtiphnkplfqalidgfregfylfpdgrnqn
pdltg

  • Chain 'B':
    No sequence available.