SCOPe 2.08: Domain d2cbla3: 2cbl A:264-351

Lineage for d2cbla3 (2cbl A:264-351)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Cbl [55587] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55588] (12 PDB entries)

8. Domain d2cbla3: 2cbl A:264-351 [40528]
   Other proteins in same PDB: d2cbla1, d2cbla2
   complexed with ca

Details for d2cbla3

PDB Entry: 2cbl, 2.1 Å

PDB Description: n-terminal domain of cbl in complex with its binding site on zap-70

PDB Compounds: (A:) proto-oncogene cbl

SCOPe Domain Sequences for d2cbla3:

Sequence; same for both SEQRES and ATOM records:

>d2cbla3 d.93.1.1 (A:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdltg

Timeline for d2cbla3:

• d2cbla3 first appeared (with stable ids) in SCOP 1.55
  
• d2cbla3 appears in SCOPe 2.07