Lineage for d2cbla1 (2cbl A:178-263)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2324560Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)
  6. 2324564Protein Cbl [47561] (1 species)
  7. 2324565Species Human (Homo sapiens) [TaxId:9606] [47562] (12 PDB entries)
  8. 2324571Domain d2cbla1: 2cbl A:178-263 [17380]
    Other proteins in same PDB: d2cbla2, d2cbla3
    complexed with ca

Details for d2cbla1

PDB Entry: 2cbl (more details), 2.1 Å

PDB Description: n-terminal domain of cbl in complex with its binding site on zap-70
PDB Compounds: (A:) proto-oncogene cbl

SCOPe Domain Sequences for d2cbla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbla1 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

SCOPe Domain Coordinates for d2cbla1:

Click to download the PDB-style file with coordinates for d2cbla1.
(The format of our PDB-style files is described here.)

Timeline for d2cbla1: