Lineage for d2cbla1 (2cbl A:178-263)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3451Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (7 proteins)
  6. 3474Protein Cbl [47561] (1 species)
  7. 3475Species Human (Homo sapiens) [TaxId:9606] [47562] (3 PDB entries)
  8. 3476Domain d2cbla1: 2cbl A:178-263 [17380]
    Other proteins in same PDB: d2cbla2, d2cbla3

Details for d2cbla1

PDB Entry: 2cbl (more details), 2.1 Å

PDB Description: n-terminal domain of cbl in complex with its binding site on zap-70

SCOP Domain Sequences for d2cbla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbla1 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens)}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

SCOP Domain Coordinates for d2cbla1:

Click to download the PDB-style file with coordinates for d2cbla1.
(The format of our PDB-style files is described here.)

Timeline for d2cbla1: