SCOPe 2.08: Domain d2vumh1: 2vum H:2-146

Lineage for d2vumh1 (2vum H:2-146)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)
Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
automatically mapped to Pfam PF03870
Protein RNA polymerase subunit RBP8 [50322] (2 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries)
Uniprot P20436

Domain d2vumh1: 2vum H:2-146 [153553]
Other proteins in same PDB: d2vuma1, d2vumb1, d2vumd1, d2vumf1, d2vumg1, d2vumj1, d2vumk1, d2vuml1
automatically matched to d1a1da_
protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2vumh1

PDB Entry: 2vum (more details), 3.4 Å

PDB Description: alpha-amanitin inhibited complete rna polymerase ii elongation complex

PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III subunit RPABC3

SCOPe Domain Sequences for d2vumh1:

Sequence, based on SEQRES records: (download)

>d2vumh1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d2vumh1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOPe Domain Coordinates for d2vumh1:

Click to download the PDB-style file with coordinates for d2vumh1.
(The format of our PDB-style files is described here.)

Timeline for d2vumh1: