Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.8: RNA polymerase [58180] (1 superfamily) |
Superfamily i.8.1: RNA polymerase [58181] (1 family) |
Family i.8.1.1: RNA polymerase [58182] (2 proteins) |
Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries) |
Domain d2vumd1: 2vum D:4-221 [153550] Other proteins in same PDB: d2vumb1, d2vumf1, d2vumh1, d2vumj1, d2vuml1 automatically matched to d1y1vd_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2vum (more details), 3.4 Å
SCOPe Domain Sequences for d2vumd1:
Sequence, based on SEQRES records: (download)
>d2vumd1 i.8.1.1 (D:4-221) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ststfqtrrrrlkkveeeenaatlqlgqefqlkqinhqgeeeelialnlsearlvikeal verrrafkrsqkkhkkkhlkhenandettavededddldeddvnaddddfmhsetrekel esidvlleqttggnnkdlkntmqyltnfsrfrdqetvgaviqllkstglhpfevaqlgsl acdtadeaktlipslnnkisddelerilkelsnletly
>d2vumd1 i.8.1.1 (D:4-221) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ststfqtrrrrlkkveeeenaatlqlgqefqlkqinhqgeeeelialnlsearlvikeal verrrafkrsqkktrekelesidvlleqttggnnkdlkntmqyltnfsrfrdqetvgavi qllkstglhpfevaqlgslacdtadeaktlipslnnkisddelerilkelsnletly
Timeline for d2vumd1: