Lineage for d2vumd1 (2vum D:4-221)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 898089Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 898090Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 898091Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 898092Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 898093Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 898109Domain d2vumd1: 2vum D:4-221 [153550]
    Other proteins in same PDB: d2vumb1, d2vumf1, d2vumh1, d2vumj1, d2vuml1
    automatically matched to d1y1vd_
    complexed with bru, ilx, mg, trx, zn

Details for d2vumd1

PDB Entry: 2vum (more details), 3.4 Å

PDB Description: alpha-amanitin inhibited complete rna polymerase ii elongation complex
PDB Compounds: (D:) DNA-directed RNA polymerase II subunit RPB4

SCOP Domain Sequences for d2vumd1:

Sequence, based on SEQRES records: (download)

>d2vumd1 i.8.1.1 (D:4-221) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ststfqtrrrrlkkveeeenaatlqlgqefqlkqinhqgeeeelialnlsearlvikeal
verrrafkrsqkkhkkkhlkhenandettavededddldeddvnaddddfmhsetrekel
esidvlleqttggnnkdlkntmqyltnfsrfrdqetvgaviqllkstglhpfevaqlgsl
acdtadeaktlipslnnkisddelerilkelsnletly

Sequence, based on observed residues (ATOM records): (download)

>d2vumd1 i.8.1.1 (D:4-221) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ststfqtrrrrlkkveeeenaatlqlgqefqlkqinhqgeeeelialnlsearlvikeal
verrrafkrsqkktrekelesidvlleqttggnnkdlkntmqyltnfsrfrdqetvgavi
qllkstglhpfevaqlgslacdtadeaktlipslnnkisddelerilkelsnletly

SCOP Domain Coordinates for d2vumd1:

Click to download the PDB-style file with coordinates for d2vumd1.
(The format of our PDB-style files is described here.)

Timeline for d2vumd1: