| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.2: RPB6 [55294] (2 proteins) |
| Protein RPB6 [55295] (3 species) essential subunit of RNA polymerases I, II and III |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries) Uniprot P20435; part of multichain biological unit |
| Domain d2vumf1: 2vum F:72-155 [153551] Other proteins in same PDB: d2vuma1, d2vumb1, d2vumd1, d2vumg1, d2vumh1, d2vumj1, d2vumk1, d2vuml1 automatically matched to d1i3qf_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2vum (more details), 3.4 Å
SCOPe Domain Sequences for d2vumf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vumf1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl
Timeline for d2vumf1: