Details for d1y1vd_

PDB Entry: 1y1v (more details), 3.8 Å

PDB Compounds: (D:) DNA-directed RNA polymerase II 32 kDa polypeptide

SCOPe Domain Sequences for d1y1vd_:

Sequence, based on SEQRES records: (download)

>d1y1vd_ i.8.1.1 (D:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ststfqtrrrrlkkveeeenaatlqlgqefqlkqinhqgeeeelialnlsearlvikeal
verrrafkrsqkkhkkkhlkhenandettavededddldeddvnaddddfmhsetrekel
esidvlleqttggnnkdlkntmqyltnfsrfrdqetvgaviqllkstglhpfevaqlgsl
acdtadeaktlipslnnkisddelerilkelsnletly

Sequence, based on observed residues (ATOM records): (download)

>d1y1vd_ i.8.1.1 (D:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ststfqtrrrrlkkveeeenaatlqlgqefqlkqinhqgeeeelialnlsearlvikeal
verrrafkrsqkktrekelesidvlleqttggnnkdlkntmqyltnfsrfrdqetvgavi
qllkstglhpfevaqlgslacdtadeaktlipslnnkisddelerilkelsnletly

SCOPe Domain Coordinates for d1y1vd_:

Timeline for d1y1vd_:

• d1y1vd_ first appeared in SCOP 1.71
  
• d1y1vd_ appears in SCOPe 2.07
  

Thumbnails for d1y1vd_:

d1y1vd_ (click for larger image) View in 3D

d1y1vd_ in context of chain View in 3D

d1y1vd_ in context of PDB d1y1va_ in context of PDB d1y1vb_ in context of PDB d1y1vc_ in context of PDB d1y1ve_ in context of PDB d1y1vf_ in context of PDB d1y1vg_ in context of PDB d1y1vh_ in context of PDB d1y1vi_ in context of PDB d1y1vj_ in context of PDB d1y1vk_ in context of PDB d1y1vl_ in context of PDB d1y1vs_ in context of PDB View in 3D Domains from other chains: (mouse over for more information) d1y1va_, d1y1vb_, d1y1vc_, d1y1ve_, d1y1vf_, d1y1vg_, d1y1vh_, d1y1vi_, d1y1vj_, d1y1vk_, d1y1vl_, d1y1vs_