| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.8: RNA polymerase [58180] (1 superfamily) |
Superfamily i.8.1: RNA polymerase [58181] (1 family) ![]() |
| Family i.8.1.1: RNA polymerase [58182] (2 proteins) |
| Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries) |
| Domain d1y1vj_: 1y1v J: [116358] protein/RNA complex; complexed with mg, zn |
PDB Entry: 1y1v (more details), 3.8 Å
SCOPe Domain Sequences for d1y1vj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y1vj_ i.8.1.1 (J:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp
Timeline for d1y1vj_: