Lineage for d1y1vg_ (1y1v G:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044682Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 3044683Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 3044684Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 3044685Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 3044686Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 3044749Domain d1y1vg_: 1y1v G: [116355]
    protein/RNA complex; complexed with mg, zn

Details for d1y1vg_

PDB Entry: 1y1v (more details), 3.8 Å

PDB Description: refined rna polymerase ii-tfiis complex
PDB Compounds: (G:) DNA-directed RNA polymerase II 19 kDa polypeptide

SCOPe Domain Sequences for d1y1vg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1vg_ i.8.1.1 (G:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdlt
fnagsnppsyqssedvitiksrirvkiegcisqvssihaigsikedylgai

SCOPe Domain Coordinates for d1y1vg_:

Click to download the PDB-style file with coordinates for d1y1vg_.
(The format of our PDB-style files is described here.)

Timeline for d1y1vg_: