Lineage for d1a1da_ (1a1d A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790275Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
    automatically mapped to Pfam PF03870
  6. 2790276Protein RNA polymerase subunit RBP8 [50322] (2 species)
  7. 2790277Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries)
    Uniprot P20436
  8. 2790313Domain d1a1da_: 1a1d A: [25394]
    CA-atoms only

Details for d1a1da_

PDB Entry: 1a1d (more details)

PDB Description: yeast rna polymerase subunit rpb8, nmr, minimized average structure, alpha carbons only
PDB Compounds: (A:) RNA polymerase

SCOPe Domain Sequences for d1a1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1da_ b.40.4.8 (A:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia
sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg
llmrlegnyrnlnnlkqenayllirr

SCOPe Domain Coordinates for d1a1da_:

Click to download the PDB-style file with coordinates for d1a1da_.
(The format of our PDB-style files is described here.)

Timeline for d1a1da_: