SCOPe 2.08: Domain d2q9qh2: 2q9q H:2-87

Lineage for d2q9qh2 (2q9q H:2-87)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
   beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)

4. Superfamily d.344.1: PriA/YqbF domain [160059] (5 families)
   associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)

5. Family d.344.1.4: PSF3 N-terminal domain-like [160071] (1 protein)
   N-terminal part of Pfam PF06425

6. Protein GINS complex subunit 3, PSF3 [160072] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160073] (3 PDB entries)
   Uniprot Q9BRX5 1-87

8. Domain d2q9qh2: 2q9q H:2-87 [150167]
   Other proteins in same PDB: d2q9qa1, d2q9qa2, d2q9qb1, d2q9qb2, d2q9qc_, d2q9qd1, d2q9qe1, d2q9qe2, d2q9qf1, d2q9qf2, d2q9qg_, d2q9qh1
   automated match to d2e9xc2

Details for d2q9qh2

PDB Entry: 2q9q, 2.36 Å

PDB Description: The crystal structure of full length human GINS complex

PDB Compounds: (H:) GINS complex subunit 3

SCOPe Domain Sequences for d2q9qh2:

Sequence, based on SEQRES records:

>d2q9qh2 d.344.1.4 (H:2-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
seayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetdnavp
qgsklelplwlakglfdnkrrilsve

Sequence, based on observed residues (ATOM records):

>d2q9qh2 d.344.1.4 (H:2-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
seayfrvesgalgpeenflslddilmsheklpvrtetamprlgaffaetdnavpqgskle
lplwlakglfdnkrrilsve

Timeline for d2q9qh2:

• d2q9qh2 first appeared in SCOP 1.75
  
• d2q9qh2 appears in SCOPe 2.07