SCOPe 2.08: Domain d2q9qf1: 2q9q F:21-165

Lineage for d2q9qf1 (2q9q F:21-165)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
   5 helices, staggered bundle;

4. Superfamily a.278.1: GINS helical bundle-like [158573] (4 families)
   common to all subunits of the GINS complex

5. Family a.278.1.4: SLD5 N-terminal domain-like [158583] (2 proteins)
   N-terminal part of Pfam PF05916

6. Protein GINS complex subunit 4, SLD5 [158584] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158585] (3 PDB entries)
   Uniprot Q9BRT9 21-165

8. Domain d2q9qf1: 2q9q F:21-165 [150164]
   Other proteins in same PDB: d2q9qa1, d2q9qa2, d2q9qb2, d2q9qc_, d2q9qd1, d2q9qd2, d2q9qe1, d2q9qe2, d2q9qf2, d2q9qg_, d2q9qh1, d2q9qh2
   automated match to d2e9xd1

Details for d2q9qf1

PDB Entry: 2q9q, 2.36 Å

PDB Description: The crystal structure of full length human GINS complex

PDB Compounds: (F:) GINS complex subunit 4

SCOPe Domain Sequences for d2q9qf1:

Sequence, based on SEQRES records:

>d2q9qf1 a.278.1.4 (F:21-165) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]}
ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenlrrakredlkvsihqm
emeriryvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesy
lknvalkhmppnlqkvdlfravpkp

Sequence, based on observed residues (ATOM records):

>d2q9qf1 a.278.1.4 (F:21-165) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]}
ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenldlkvsihqmemerir
yvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesylknval
khmppnlqkvdlfravpkp

Timeline for d2q9qf1:

• d2q9qf1 first appeared in SCOP 1.75
  
• d2q9qf1 appears in SCOPe 2.07