| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.278: GINS helical bundle-like [158572] (1 superfamily) 5 helices, staggered bundle; |
Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) ![]() common to all subunits of the GINS complex |
| Family a.278.1.4: SLD5 N-terminal domain-like [158583] (2 proteins) N-terminal part of Pfam PF05916 |
| Protein GINS complex subunit 4, SLD5 [158584] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158585] (3 PDB entries) Uniprot Q9BRT9 21-165 |
| Domain d2q9qb1: 2q9q B:21-165 [150158] Other proteins in same PDB: d2q9qa1, d2q9qa2, d2q9qb2, d2q9qc_, d2q9qd1, d2q9qd2, d2q9qe1, d2q9qe2, d2q9qf2, d2q9qg_, d2q9qh1, d2q9qh2 automated match to d2e9xd1 |
PDB Entry: 2q9q (more details), 2.36 Å
SCOPe Domain Sequences for d2q9qb1:
Sequence, based on SEQRES records: (download)
>d2q9qb1 a.278.1.4 (B:21-165) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]}
ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenlrrakredlkvsihqm
emeriryvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesy
lknvalkhmppnlqkvdlfravpkp
>d2q9qb1 a.278.1.4 (B:21-165) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]}
ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenldlkvsihqmemerir
yvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesylknval
khmppnlqkvdlfravpkp
Timeline for d2q9qb1: