Lineage for d2q9qd2 (2q9q D:2-87)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216674Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
    beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)
  4. 2216675Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) (S)
    associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)
  5. 2216694Family d.344.1.4: PSF3 N-terminal domain-like [160071] (1 protein)
    N-terminal part of Pfam PF06425
  6. 2216695Protein GINS complex subunit 3, PSF3 [160072] (1 species)
  7. 2216696Species Human (Homo sapiens) [TaxId:9606] [160073] (3 PDB entries)
    Uniprot Q9BRX5 1-87
  8. 2216699Domain d2q9qd2: 2q9q D:2-87 [150161]
    Other proteins in same PDB: d2q9qa1, d2q9qa2, d2q9qb1, d2q9qb2, d2q9qc_, d2q9qd1, d2q9qe1, d2q9qe2, d2q9qf1, d2q9qf2, d2q9qg_, d2q9qh1
    automated match to d2e9xc2

Details for d2q9qd2

PDB Entry: 2q9q (more details), 2.36 Å

PDB Description: The crystal structure of full length human GINS complex
PDB Compounds: (D:) GINS complex subunit 3

SCOPe Domain Sequences for d2q9qd2:

Sequence, based on SEQRES records: (download)

>d2q9qd2 d.344.1.4 (D:2-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
seayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetdnavp
qgsklelplwlakglfdnkrrilsve

Sequence, based on observed residues (ATOM records): (download)

>d2q9qd2 d.344.1.4 (D:2-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
seayfrvesgalgpeenflslddilmsheklpvrtetamprlgaffaetdnavpqgskle
lplwlakglfdnkrrilsve

SCOPe Domain Coordinates for d2q9qd2:

Click to download the PDB-style file with coordinates for d2q9qd2.
(The format of our PDB-style files is described here.)

Timeline for d2q9qd2: