![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.278: GINS helical bundle-like [158572] (1 superfamily) 5 helices, staggered bundle; |
![]() | Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) ![]() common to all subunits of the GINS complex |
![]() | Family a.278.1.1: PSF1 N-terminal domain-like [158574] (2 proteins) |
![]() | Protein automated matches [254623] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255556] (1 PDB entry) |
![]() | Domain d2q9qc_: 2q9q C: [238824] Other proteins in same PDB: d2q9qa1, d2q9qa2, d2q9qb1, d2q9qb2, d2q9qd1, d2q9qd2, d2q9qe1, d2q9qe2, d2q9qf1, d2q9qf2, d2q9qh1, d2q9qh2 automated match to d2ehob1 |
PDB Entry: 2q9q (more details), 2.36 Å
SCOPe Domain Sequences for d2q9qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q9qc_ a.278.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdlip tikfrhcsllrnrrctvaylydrllriralrweygsilpnalrfhmaaeemewfnnykrs latymrslggdeglditqdmkppks
Timeline for d2q9qc_: