| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.278: GINS helical bundle-like [158572] (1 superfamily) 5 helices, staggered bundle; |
Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) ![]() common to all subunits of the GINS complex |
| Family a.278.1.2: PSF2 C-terminal domain-like [158577] (1 protein) C-terminal part of Pfam PF05916 |
| Protein DNA replication complex GINS protein PSF2 [158578] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158579] (3 PDB entries) Uniprot Q9Y248 62-173 |
| Domain d2q9qa1: 2q9q A:62-175 [150156] Other proteins in same PDB: d2q9qa2, d2q9qb1, d2q9qb2, d2q9qc_, d2q9qd1, d2q9qd2, d2q9qe2, d2q9qf1, d2q9qf2, d2q9qg_, d2q9qh1, d2q9qh2 automated match to d2q9qa1 |
PDB Entry: 2q9q (more details), 2.36 Å
SCOPe Domain Sequences for d2q9qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q9qa1 a.278.1.2 (A:62-175) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]}
ppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkdmw
dtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtnlq
Timeline for d2q9qa1: