SCOPe 2.08: Domain d2q9qe1: 2q9q E:62-175

Lineage for d2q9qe1 (2q9q E:62-175)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
   5 helices, staggered bundle;

4. Superfamily a.278.1: GINS helical bundle-like [158573] (4 families)
   common to all subunits of the GINS complex

5. Family a.278.1.2: PSF2 C-terminal domain-like [158577] (1 protein)
   C-terminal part of Pfam PF05916

6. Protein DNA replication complex GINS protein PSF2 [158578] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158579] (3 PDB entries)
   Uniprot Q9Y248 62-173

8. Domain d2q9qe1: 2q9q E:62-175 [150162]
   Other proteins in same PDB: d2q9qa2, d2q9qb1, d2q9qb2, d2q9qc_, d2q9qd1, d2q9qd2, d2q9qe2, d2q9qf1, d2q9qf2, d2q9qg_, d2q9qh1, d2q9qh2
   automated match to d2q9qe1

Details for d2q9qe1

PDB Entry: 2q9q, 2.36 Å

PDB Description: The crystal structure of full length human GINS complex

PDB Compounds: (E:) DNA replication complex GINS protein PSF2

SCOPe Domain Sequences for d2q9qe1:

Sequence; same for both SEQRES and ATOM records:

>d2q9qe1 a.278.1.2 (E:62-175) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]}
ppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkdmw
dtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtnlq

Timeline for d2q9qe1:

• d2q9qe1 first appeared in SCOP 1.75
  
• d2q9qe1 appears in SCOPe 2.07