SCOPe 2.08: Domain d2nn6i1: 2nn6 I:61-185

Lineage for d2nn6i1 (2nn6 I:61-185)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
   barrel, closed; n=5, S=8

6. Protein Exosome component 1, EXOSC1 [159098] (1 species)
   3'-5' exoribonuclease CSL4 homolog

7. Species Human (Homo sapiens) [TaxId:9606] [159099] (1 PDB entry)
   Uniprot Q9Y3B2 61-185

8. Domain d2nn6i1: 2nn6 I:61-185 [148313]
   Other proteins in same PDB: d2nn6a1, d2nn6a2, d2nn6b1, d2nn6b2, d2nn6c1, d2nn6c2, d2nn6d1, d2nn6d2, d2nn6e1, d2nn6e2, d2nn6f1, d2nn6f2, d2nn6g1, d2nn6g2, d2nn6g3, d2nn6h1, d2nn6h2, d2nn6h3, d2nn6i2
   includes extra C-terminal subdomain of a rubredoxin-like fold that is lacking the zinc-binding residues
   protein/RNA complex
   has additional subdomain(s) that are not in the common domain

Details for d2nn6i1

PDB Entry: 2nn6, 3.35 Å

PDB Description: Structure of the human RNA exosome composed of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, and Rrp40

PDB Compounds: (I:) 3'-5' exoribonuclease CSL4 homolog

SCOPe Domain Sequences for d2nn6i1:

Sequence; same for both SEQRES and ATOM records:

>d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]}
sqllpdvgaivtckvssinsrfakvhilyvgsmplknsfrgtirkedvratekdkveiyk
sfrpgdivlakvislgdaqsnyllttaenelgvvvahsesgiqmvpiswcemqcpkthtk
efrkv

Timeline for d2nn6i1:

• d2nn6i1 first appeared in SCOP 1.75
  
• d2nn6i1 appears in SCOPe 2.07