PDB entry 2nn6

View 2nn6 on RCSB PDB site
Description: Structure of the human RNA exosome composed of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, and Rrp40
Class: hydrolase/transferase
Keywords: RNA, exosome, PM/Scl, exoribonuclease, phosphorolytic, ribonuclease, HYDROLASE/TRANSFERASE COMPLEX
Deposited on 2006-10-23, released 2006-12-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.35 Å
R-factor: 0.291
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymyositis/scleroderma autoantigen 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PMSCL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nn6a1, d2nn6a2
  • Chain 'B':
    Compound: Exosome complex exonuclease RRP41
    Species: Homo sapiens [TaxId:9606]
    Gene: EXOSC4, RRP41, SKI6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nn6b1, d2nn6b2
  • Chain 'C':
    Compound: Exosome complex exonuclease RRP43
    Species: Homo sapiens [TaxId:9606]
    Gene: EXOSC8, OIP2, RRP43
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nn6c1, d2nn6c2
  • Chain 'D':
    Compound: Exosome complex exonuclease RRP46
    Species: Homo sapiens [TaxId:9606]
    Gene: EXOSC5, CML28, RRP46
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nn6d1, d2nn6d2
  • Chain 'E':
    Compound: Exosome complex exonuclease RRP42
    Species: Homo sapiens [TaxId:9606]
    Gene: EXOSC7, KIAA0116, RRP42
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15024
      • variant (287)
    Domains in SCOPe 2.06: d2nn6e1, d2nn6e2
  • Chain 'F':
    Compound: Exosome component 6
    Species: Homo sapiens [TaxId:9606]
    Gene: EXOSC6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nn6f1, d2nn6f2
  • Chain 'G':
    Compound: exosome complex exonuclease rrp40
    Species: Homo sapiens [TaxId:9606]
    Gene: EXOSC3, RRP40
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nn6g1, d2nn6g2, d2nn6g3
  • Chain 'H':
    Compound: Exosome complex exonuclease RRP4
    Species: Homo sapiens [TaxId:9606]
    Gene: EXOSC2, RRP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nn6h1, d2nn6h2, d2nn6h3
  • Chain 'I':
    Compound: 3'-5' exoribonuclease CSL4 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: EXOSC1, CSL4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nn6i1, d2nn6i2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nn6A (A:)
    mgsshhhhhhsqdpnshmketplsncerrfllraieekkrldgrqtydyrnirisfgtdy
    gccivelgktrvlgqvscelvspklnrategilffnlelsqmaapafepgrqsdllvkln
    rlmerclrnskcidteslcvvagekvwqirvdlhllnhdgniidaasiaaivalchfrrp
    dvsvqgdevtlytpeerdpvplsihhmpicvsfaffqqgtyllvdpnereervmdgllvi
    amnkhreictiqssggimllkdqvlrcskiagvkvaeitelilkalendqkvrkeggkfg
    faesianqritafkmekapxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nn6A (A:)
    mketplsncerrfllraieekkrldgrqtydyrnirisfgtdygccivelgktrvlgqvs
    celvspklnrategilffnlelsqmaapafepgrqsdllvklnrlmerclrnskcidtes
    lcvvagekvwqirvdlhllnhdgniidaasiaaivalchfrrpdvsvqgdevtlytpeer
    dpvplsihhmpicvsfaffqqgtyllvdpnereervmdgllviamnkhreictiqssggi
    mllkdqvlrcskiagvkvaeitelilkalendqkvrkeggkfgfaesianqritafkmek
    apxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nn6B (B:)
    madpmaglellsdqgyrvdgrragelrkiqarmgvfaqadgsayieqgntkalavvygph
    eirgsraralpdralvncqyssatfstgerkrrphgdrkscemglqlrqtfeaailtqlh
    prsqidiyvqvlqadggtyaacvnaatlavldagipmrdfvcacsagfvdgtaladlshv
    eeaaggpqlalallpasgqiallemdarlhedhlervleaaaqaardvhtlldrvvrqhv
    reasillgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nn6B (B:)
    lsdqgyrvdgrragelrkiqarmgvfaqadgsayieqgntkalavvygpheirgsraral
    pdralvncqyssatfstgerkrrphgdrkscemglqlrqtfeaailtqlhprsqidiyvq
    vlqadggtyaacvnaatlavldagipmrdfvcacsagfvdgtaladlshveeaaggpqla
    lallpasgqiallemdarlhedhlervleaaaqaardvhtlldrvvrqhvreasi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nn6C (C:)
    dpmaagfktvepleyyrrflkencrpdgrelgefrtttvnigsistadgsalvklgnttv
    icgvkaefaapstdapdkgyvvpnvdlpplcssrfrsgppgeeaqvasqfiadviensqi
    iqkedlcispgklvwvlycdlicldydgnildactfallaalknvqlpevtineetalae
    vnlkkksylnirthpvatsfavfddtllivdptgeeehlatgtltivmdeegklcclhkp
    ggsgltgaklqdcmsravtrhkevkklmdeviksmkpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nn6C (C:)
    tvepleyyrrflkencrpdgrelgefrtttvnigsistadgsalvklgnttvicgvkaef
    aapstdapdkgyvvpnvdlpplcssrfrsgppgeeaqvasqfiadviensqiiqkedlci
    spgklvwvlycdlicldydgnildactfallaalknvqlpevtineetalaevnlkkksy
    lnirthpvatsfavfddtllivdptgeeehlatgtltivmdeegklcclhkpggsgltga
    klqdcmsravtrhkevkklmdeviksmkpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nn6D (D:)
    slmeeethtdakiraengtgssprgpgcslrhfaceqnllsrpdgsasflqgdtsvlagv
    ygpaevkvskeifnkatlevilrpkiglpgvaeksrerlirntceavvlgtlhprtsitv
    vlqvvsdagsllacclnaacmalvdagvpmralfcgvacaldsdgtlvldptskqekear
    avltfaldsverkllmsstkglysdtelqqclaaaqaasqhvfrfyreslqrrysks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nn6D (D:)
    gcslrhfaceqnllsrpdgsasflqgdtsvlagvygpaevknkatlevilrpkiglpgva
    eksrerlirntceavvlgtlhprtsitvvlqvvsdagsllacclnaacmalvdagvpmra
    lfcgvacaldsdgtlvldptskqekearavltfaldsverkllmsstkglysdtelqqcl
    aaaqaasqhvfrfyreslqrrysks
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2nn6E (E:)
    mgsshhhhhhsqdpmasvtlseaekvyivhgvqedlrvdgrgcedyrcvevetdvvsnts
    gsarvklghtdilvgvkaemgtpklekpnegyleffvdcsasatpefegrggddlgteia
    ntlyrifnnkssvdlktlcisprehcwvlyvdvlllecggnlfdaisiavkaalfntrip
    rvrvledeegskdielsddpydcirlsvenvpcivtlckigyrhvvdatlqeeacslasl
    lvsvtskgvvtcmrkvgkgsldpesifemmetgkrvgkvlhaslqsvvhkeeslgpkrqk
    vgflg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nn6E (E:)
    tlseaekvyivhgvqedlrvdgrgcedyrcvevetdvvsntsgsarvklghtdilvgvka
    emgtpklekpnegyleffvdcsasatpefegrggddlgteiantlyrifnnkssvdlktl
    cisprehcwvlyvdvlllecggnlfdaisiavkaalfntriprvrvledielsddpydci
    rlsvenvpcivtlckigyrhvvdatlqeeacslasllvsvtskgvvtcmrkvgkgsldpe
    sifemmetgkrvgkvlhaslqsvvhkeeslgpkrq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2nn6F (F:)
    mpgdhrrirgpeesqppqlyaadeeeapgtrdptrlrpvyaragllsqakgsayleaggt
    kvlcavsgprqaeggergggpagaggeapaalrgrllcdfrrapfagrrrrappggceer
    elalalqealepavrlgrypraqlevsallledggsalaaaltaaalaladagvemydlv
    vgcglslapgpaptwlldptrleeeraaagltvalmpvlnqvagllgsgegglteswaea
    vrlglegcqrlypvlqqslvraarrrgaaaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nn6F (F:)
    gtrdptrlrpvyaragllsqakgsayleaggtkvlcavsgprqalrgrllcdfrrapfag
    rrrrappggceerelalalqealepavrlgrypraqlevsallledggsalaaaltaaal
    aladagvemydlvvgcglslapgpaptwlldptrleeeraaagltvalmpvlnqvagllg
    sgegglteswaeavrlglegcqrlypvlqqslvraarrrgaaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2nn6G (G:)
    mgsshhhhhhsqdpmaepasvaaeslagsraraartvlgqvvlpgeelllpeqedaegpg
    gaverplslnaracsrvrvvcgpglrrcgdrllvtkcgrlrhkepgsgsgggvywvdsqq
    kryvpvkgdhvigivtaksgdifkvdvggsepaslsylsfegatkrnrpnvqvgdliygq
    fvvankdmepemvcidscgrangmgvigqdgllfkvtlglirkllapdceiiqevgklyp
    leivfgmngriwvkaktiqqtlilanileacehmtsdqrkqifsrlaes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nn6G (G:)
    araartvlgqvvlpgeelllpeqedaegpggavergdrllvtkcgrlrhkepgsgsgggv
    ywvdsqqkryvpvkgdhvigivtaksgdifkvdvggsepaslsylsfegatkrnrpnvqv
    gdliygqfvvankdmepemvcidscgrangmgvigqdgllfkvtlglirkllapdceiiq
    evgklypleivfgmngriwvkaktiqqtlilanileacehmtsdqrkqifsrlaes
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2nn6H (H:)
    mgsshhhhhhsqdphmamemrlpvarkplserlgrdtkkhlvvpgdtittdtgfmrghgt
    ymgeekliasvagsvervnklicvkalktryigevgdivvgritevqqkrwkvetnsrld
    svlllssmnlpggelrrrsaedelamrgflqegdlisaevqavfsdgavslhtrslkygk
    lgqgvlvqvspslvkrqkthfhdlpcgasvilgnngfiwiyptpehkeeeaggfianlep
    vsladrevisrlrnciislvtqrmmlydtsilycyeaslphqikdilkpeimeeivmetr
    qrlleqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nn6H (H:)
    hlvvpgdtittdtgfmrghgtymgeekliasvagsvervnklicvkalktryigevgdiv
    vgritevqqkrwkvetnsrldsvlllssmnelamrgflqegdlisaevqavfsdgavslh
    trslkygklgqgvlvqvspslvkrqkthfhdlpcgasvilgnngfiwiyptpehgfianl
    epvsladrevisrlrnciislvtqrmmlydtsilycyeaslphqikdilkpeimeeivme
    trqrlleqeg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2nn6I (I:)
    mgsshhhhhhsqdpmappvrycipgerlcnleegspgsgtytrhgyifsslagclmksse
    ngalpvvsvvretesqllpdvgaivtckvssinsrfakvhilyvgsmplknsfrgtirke
    dvratekdkveiyksfrpgdivlakvislgdaqsnyllttaenelgvvvahsesgiqmvp
    iswcemqcpkthtkefrkvarvqpeflqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nn6I (I:)
    rycipgerlcnleegspgsgtytrhgyifsslagclmkssengalpvvsvvretesqllp
    dvgaivtckvssinsrfakvhilyvgsmplknsfrgtirkedvratekdkveiyksfrpg
    divlakvislgdaqsnyllttaenelgvvvahsesgiqmvpiswcemqcpkthtkefrkv