Lineage for d2nn6h2 (2nn6 H:25-72)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817766Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 2817817Family b.84.4.2: ECR1 N-terminal domain-like [159324] (4 proteins)
    ECR1 - Exosome complex RNA-binding protein 1
  6. 2817831Protein Ribosomal RNA-processing protein 4, RRP4 [159332] (1 species)
  7. 2817832Species Human (Homo sapiens) [TaxId:9606] [159333] (1 PDB entry)
    Uniprot Q13868 25-72
  8. 2817833Domain d2nn6h2: 2nn6 H:25-72 [148311]
    Other proteins in same PDB: d2nn6a1, d2nn6a2, d2nn6b1, d2nn6b2, d2nn6c1, d2nn6c2, d2nn6d1, d2nn6d2, d2nn6e1, d2nn6e2, d2nn6f1, d2nn6f2, d2nn6g1, d2nn6g2, d2nn6g3, d2nn6h1, d2nn6h3, d2nn6i1, d2nn6i2
    protein/RNA complex

Details for d2nn6h2

PDB Entry: 2nn6 (more details), 3.35 Å

PDB Description: Structure of the human RNA exosome composed of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, and Rrp40
PDB Compounds: (H:) Exosome complex exonuclease RRP4

SCOPe Domain Sequences for d2nn6h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nn6h2 b.84.4.2 (H:25-72) Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]}
hlvvpgdtittdtgfmrghgtymgeekliasvagsvervnklicvkal

SCOPe Domain Coordinates for d2nn6h2:

Click to download the PDB-style file with coordinates for d2nn6h2.
(The format of our PDB-style files is described here.)

Timeline for d2nn6h2: