Lineage for d2nn6f2 (2nn6 F:176-270)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186677Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2186678Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2186679Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 protein domains)
  6. 2186773Protein Exosome complex exonuclease MTR3 [160600] (1 species)
  7. 2186774Species Human (Homo sapiens) [TaxId:9606] [160601] (1 PDB entry)
    Uniprot Q5RKV6 176-270
  8. 2186775Domain d2nn6f2: 2nn6 F:176-270 [148306]
    Other proteins in same PDB: d2nn6a1, d2nn6a2, d2nn6b1, d2nn6b2, d2nn6c1, d2nn6c2, d2nn6d1, d2nn6d2, d2nn6e1, d2nn6e2, d2nn6f1, d2nn6g1, d2nn6g2, d2nn6g3, d2nn6h1, d2nn6h2, d2nn6h3, d2nn6i1, d2nn6i2
    protein/RNA complex

Details for d2nn6f2

PDB Entry: 2nn6 (more details), 3.35 Å

PDB Description: Structure of the human RNA exosome composed of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, and Rrp40
PDB Compounds: (F:) Exosome component 6

SCOPe Domain Sequences for d2nn6f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nn6f2 d.101.1.1 (F:176-270) Exosome complex exonuclease MTR3 {Human (Homo sapiens) [TaxId: 9606]}
mydlvvgcglslapgpaptwlldptrleeeraaagltvalmpvlnqvagllgsgegglte
swaeavrlglegcqrlypvlqqslvraarrrgaaa

SCOPe Domain Coordinates for d2nn6f2:

Click to download the PDB-style file with coordinates for d2nn6f2.
(The format of our PDB-style files is described here.)

Timeline for d2nn6f2: