Lineage for d2nn6g1 (2nn6 G:107-194)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2790128Protein S1-domain of exosome component 3 (RRP40) [159091] (2 species)
  7. 2790131Species Human (Homo sapiens) [TaxId:9606] [159093] (1 PDB entry)
    Uniprot Q9NQT5 108-195
  8. 2790132Domain d2nn6g1: 2nn6 G:107-194 [148307]
    Other proteins in same PDB: d2nn6a1, d2nn6a2, d2nn6b1, d2nn6b2, d2nn6c1, d2nn6c2, d2nn6d1, d2nn6d2, d2nn6e1, d2nn6e2, d2nn6f1, d2nn6f2, d2nn6g2, d2nn6g3, d2nn6h1, d2nn6h2, d2nn6h3, d2nn6i1, d2nn6i2
    protein/RNA complex

Details for d2nn6g1

PDB Entry: 2nn6 (more details), 3.35 Å

PDB Description: Structure of the human RNA exosome composed of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, and Rrp40
PDB Compounds: (G:) exosome complex exonuclease rrp40

SCOPe Domain Sequences for d2nn6g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]}
ryvpvkgdhvigivtaksgdifkvdvggsepaslsylsfegatkrnrpnvqvgdliygqf
vvankdmepemvcidscgrangmgvigq

SCOPe Domain Coordinates for d2nn6g1:

Click to download the PDB-style file with coordinates for d2nn6g1.
(The format of our PDB-style files is described here.)

Timeline for d2nn6g1: