Lineage for d2hguy1 (2hgu Y:3-179)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802937Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2802938Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2802939Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 2802974Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 2802982Species Thermus thermophilus [TaxId:274] [63799] (16 PDB entries)
  8. 2802994Domain d2hguy1: 2hgu Y:3-179 [145391]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1
    protein/RNA complex
    protein/RNA complex
    has additional subdomain(s) that are not in the common domain

Details for d2hguy1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (Y:) 50S ribosomal protein L25

SCOPe Domain Sequences for d2hguy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hguy1 b.53.1.1 (Y:3-179) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]}
yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped

SCOPe Domain Coordinates for d2hguy1:

Click to download the PDB-style file with coordinates for d2hguy1.
(The format of our PDB-style files is described here.)

Timeline for d2hguy1: