SCOPe 2.08: Domain d2hgu81: 2hgu 8:1-37

Lineage for d2hgu81 (2hgu 8:1-37)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.42: Ribosomal protein L36 [57839] (1 superfamily)
   zinc-bound beta-ribbon motif

4. Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family)
   automatically mapped to Pfam PF00444

5. Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein)

6. Protein Ribosomal protein L36 [57842] (3 species)

7. Species Thermus thermophilus [TaxId:274] [57843] (10 PDB entries)

8. Domain d2hgu81: 2hgu 8:1-37 [136461]
   Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
   protein/RNA complex
   protein/RNA complex

Details for d2hgu81

PDB Entry: 2hgu, 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.

PDB Compounds: (8:) 50S ribosomal protein L36

SCOPe Domain Sequences for d2hgu81:

Sequence; same for both SEQRES and ATOM records:

>d2hgu81 g.42.1.1 (8:1-37) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]}
mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg

Timeline for d2hgu81:

• d2hgu81 first appeared in SCOP 1.73
  
• d2hgu81 appears in SCOPe 2.07