Lineage for d2hgut1 (2hgu T:2-118)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734855Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2734896Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 2734897Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 2734898Protein Ribosomal protein L20 [74733] (4 species)
  7. 2734938Species Thermus thermophilus [TaxId:274] [158510] (15 PDB entries)
    Uniprot P60491 1-117
  8. 2734948Domain d2hgut1: 2hgu T:2-118 [145386]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hgut1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (T:) 50S ribosomal protein L20

SCOPe Domain Sequences for d2hgut1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgut1 a.144.2.1 (T:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]}
praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg

SCOPe Domain Coordinates for d2hgut1:

Click to download the PDB-style file with coordinates for d2hgut1.
(The format of our PDB-style files is described here.)

Timeline for d2hgut1: