Lineage for d2hgur1 (2hgu R:23-108)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2887539Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2887540Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 2887541Protein Ribosomal protein L18 (L18p) [53139] (5 species)
  7. 2887622Species Thermus thermophilus [TaxId:274] [75245] (7 PDB entries)
  8. 2887628Domain d2hgur1: 2hgu R:23-108 [145385]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hgur1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (R:) 50S ribosomal protein L18

SCOPe Domain Sequences for d2hgur1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgur1 c.55.4.1 (R:23-108) Ribosomal protein L18 (L18p) {Thermus thermophilus [TaxId: 274]}
rlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnktevarqvgralaekalalgi
kqvafdrgpykyhgrvkalaegareg

SCOPe Domain Coordinates for d2hgur1:

Click to download the PDB-style file with coordinates for d2hgur1.
(The format of our PDB-style files is described here.)

Timeline for d2hgur1: