Lineage for d2hguq1 (2hgu Q:14-118)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005595Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 3005596Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
    automatically mapped to Pfam PF01196
  5. 3005597Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 3005598Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 3005636Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)
  8. 3005650Domain d2hguq1: 2hgu Q:14-118 [145384]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hguq1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (Q:) 50S ribosomal protein L17

SCOPe Domain Sequences for d2hguq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hguq1 d.188.1.1 (Q:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOPe Domain Coordinates for d2hguq1:

Click to download the PDB-style file with coordinates for d2hguq1.
(The format of our PDB-style files is described here.)

Timeline for d2hguq1: