Lineage for d2hgu71 (2hgu 7:2-64)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010320Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 3010321Superfamily d.301.1: L35p-like [143034] (1 family) (S)
    automatically mapped to Pfam PF01632
  5. 3010322Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 3010323Protein Ribosomal protein L35p [143036] (3 species)
  7. 3010359Species Thermus thermophilus [TaxId:274] [160057] (9 PDB entries)
    Uniprot P80341 1-64
  8. 3010364Domain d2hgu71: 2hgu 7:2-64 [145367]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hgu71

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (7:) 50S ribosomal protein L35

SCOPe Domain Sequences for d2hgu71:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgu71 d.301.1.1 (7:2-64) Ribosomal protein L35p {Thermus thermophilus [TaxId: 274]}
pkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikll
lpy

SCOPe Domain Coordinates for d2hgu71:

Click to download the PDB-style file with coordinates for d2hgu71.
(The format of our PDB-style files is described here.)

Timeline for d2hgu71: