Lineage for d2hguu1 (2hgu U:1-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825200Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 2825201Superfamily b.155.1: L21p-like [141091] (1 family) (S)
    automatically mapped to Pfam PF00829
  5. 2825202Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 2825203Protein Ribosomal protein L21p [141093] (3 species)
  7. 2825239Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries)
    Uniprot P60492 1-101
  8. 2825249Domain d2hguu1: 2hgu U:1-101 [145387]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hguu1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (U:) 50S ribosomal protein L21

SCOPe Domain Sequences for d2hguu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hguu1 b.155.1.1 (U:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg

SCOPe Domain Coordinates for d2hguu1:

Click to download the PDB-style file with coordinates for d2hguu1.
(The format of our PDB-style files is described here.)

Timeline for d2hguu1: